SARS-Cov-2 Spike Glycoprotein Receptor Binding Domain, RBD (319-541), His tag
Catalog #: EG-302
$0.00
Product Description
| Product Name | SARS-CoV-2 Spike Glycoprotein RBD (Recombinant) |
| Catalog Number | EG-302 |
| Description | Recombinant SARS-CoV-2 spike glycoprotein receptor-binding domain (RBD, Arg319–Phe541, Wuhan-Hu-1, GenBank: QHD43416.1) expressed in HEK293 cells, with a C-terminal hexa-histidine tag. Purified by nickel affinity and ion exchange chromatography. |
| Mutations | Wild-type (Wuhan-Hu-1 reference) |
| Tags | C-terminal 6xHis |
| Purification | FPLC (nickel affinity and ion exchange chromatography) |
| Sequence |
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVEGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFGSHHHHHH
|
| Molecular Weight | 25.9 kDa (theoretical) |
| Source | HEK293 cells |
| Purity | ≥90% by SDS-PAGE |
| Applications | Western blot, ELISA, and animal immunization studies |
| Storage Buffer | PBS with 50% glycerol |
| Storage | -20°C to -80°C |
| Shipping | Dry ice |
Related Products