Product Description
| Product Name | SARS-CoV-2 Spike Glycoprotein RBD, South African Variant, His Tag |
| Catalog Number | EG-323 |
| Description | Recombinant SARS-CoV-2 spike glycoprotein receptor-binding domain (RBD, Arg319–Phe541, South African variant, B.1.351) with mutations K417N, E484K, and N501Y compared to Wuhan-Hu-1 (GenBank: QHD43416.1). Expressed in HEK293 cells, purified by FPLC using nickel affinity and ion exchange chromatography, with a C-terminal 6xHis tag. |
| Mutations | K417N, E484K, N501Y |
| Tags | C-terminal 6xHis |
| Purification | FPLC (nickel affinity and ion exchange chromatography) |
| Sequence |
RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFK 60
CYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGNIADYNYKLPDDFTGCVIAWNS 120
NNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQ 180
PTYGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNFHHHHHH 228
|
| Molecular Weight | 26.0 kDa (theoretical) |
| Source | HEK293 cells |
| Purity | ≥90% by SDS-PAGE |
| Applications | Western blot, ELISA, animal immunization studies |
| Storage Buffer | PBS with 50% glycerol |
| Storage | -20°C to -80°C |
| Shipping | Dry ice |
Product Documents
DatasheetEG-323 Product Datasheet
Download PDFRelated Products
SARS-Cov-2 Spike Glycoprotein Receptor Binding Domain, RBD (319-541), His tag
View DetailsCatalog #: EG-302$298.00
SARS-CoV-2 Spike Glycoprotein, Stabilized Trimer, His tag
View DetailsCatalog #: EG-303$298.00
SARS-CoV-2 Spike Glycoprotein D614G mutant, Stabilized Trimer, His tag
View DetailsCatalog #: EG-304$298.00
SARS-CoV-2 Spike Glycoprotein RBD (319-541), United Kingdom Variant, His tag
View DetailsCatalog #: EG-324$298.00
SARS-CoV-2 Spike Glycoprotein, HexaPro Stabilized Trimer, His and Twin-Strep Tags
View DetailsCatalog #: EG-325$298.00
SARS-CoV-2 Spike Glycoprotein S1 Domain, His Tag
View DetailsCatalog #: EG-326$298.00